SCOPe 2.07: Domain d3dxra_: 3dxr A:

Lineage for d3dxra_ (3dxr A:)

1. Root: SCOPe 2.07

2. Class g: Small proteins [56992] (98 folds)

3. Fold g.83: Tim10-like [144121] (1 superfamily)
   alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure

4. Superfamily g.83.1: Tim10-like [144122] (2 families)

5. Family g.83.1.0: automated matches [227235] (1 protein)
   not a true family

6. Protein automated matches [226989] (1 species)
   not a true protein

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225569] (1 PDB entry)

8. Domain d3dxra_: 3dxr A: [209353]
   automated match to d2bska1

Details for d3dxra_

PDB Entry: 3dxr, 2.5 Å

PDB Description: crystal structure of the yeast inter-membrane space chaperone assembly tim9.10

PDB Compounds: (A:) Mitochondrial import inner membrane translocase subunit TIM9

SCOPe Domain Sequences for d3dxra_:

Sequence; same for both SEQRES and ATOM records:

>d3dxra_ g.83.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
fqkvveqkqmkdfmrlysnlvercftdcvndfttskltnkeqtcimkcsekflkhservg
qrfqeqnaa

Timeline for d3dxra_:

• d3dxra_ first appeared in SCOPe 2.03
  
• d3dxra_ appears in SCOPe 2.06
  
• d3dxra_ appears in the current release, SCOPe 2.08