Class g: Small proteins [56992] (98 folds) |
Fold g.83: Tim10-like [144121] (1 superfamily) alpha-hairpin crosslinked by two disulfides; assembles into a heterohexameric ring-like structure |
Superfamily g.83.1: Tim10-like [144122] (2 families) |
Family g.83.1.0: automated matches [227235] (1 protein) not a true family |
Protein automated matches [226989] (1 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225569] (1 PDB entry) |
Domain d3dxra_: 3dxr A: [209353] automated match to d2bska1 |
PDB Entry: 3dxr (more details), 2.5 Å
SCOPe Domain Sequences for d3dxra_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dxra_ g.83.1.0 (A:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} fqkvveqkqmkdfmrlysnlvercftdcvndfttskltnkeqtcimkcsekflkhservg qrfqeqnaa
Timeline for d3dxra_: