SCOPe 2.05: Domain d3dx9d2: 3dx9 D:130-257

Lineage for d3dx9d2 (3dx9 D:130-257)

Root: SCOPe 2.05
Class b: All beta proteins [48724] (176 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein automated matches [190374] (14 species)
not a true protein
Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)
Domain d3dx9d2: 3dx9 D:130-257 [209351]
Other proteins in same PDB: d3dx9a1, d3dx9b1, d3dx9c1, d3dx9d1
automated match to d1qsee2

Details for d3dx9d2

PDB Entry: 3dx9 (more details), 2.75 Å

PDB Description: Crystal Structure of the DM1 TCR at 2.75A

PDB Compounds: (D:) DM1 T cell receptor beta chain

SCOPe Domain Sequences for d3dx9d2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx9d2 b.1.1.2 (D:130-257) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeawgrad

SCOPe Domain Coordinates for d3dx9d2:

Click to download the PDB-style file with coordinates for d3dx9d2.
(The format of our PDB-style files is described here.)

Timeline for d3dx9d2: