Lineage for d3dx9d1 (3dx9 D:2-129)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2365565Species Human (Homo sapiens) [TaxId:9606] [187920] (1626 PDB entries)
  8. 2367421Domain d3dx9d1: 3dx9 D:2-129 [209350]
    Other proteins in same PDB: d3dx9a1, d3dx9a2, d3dx9b2, d3dx9c1, d3dx9c2, d3dx9d2
    automated match to d1qrne1

Details for d3dx9d1

PDB Entry: 3dx9 (more details), 2.75 Å

PDB Description: Crystal Structure of the DM1 TCR at 2.75A
PDB Compounds: (D:) DM1 T cell receptor beta chain

SCOPe Domain Sequences for d3dx9d1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx9d1 b.1.1.0 (D:2-129) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tgvsqnprhkitkrgqnvtfrcdpisehnrlywyrqtlgqgpefltyfqneaqleksrll
sdrfsaerpkgsfstleiqrteqgdsamylcasryrddsyneqffgpgtrltvled

SCOPe Domain Coordinates for d3dx9d1:

Click to download the PDB-style file with coordinates for d3dx9d1.
(The format of our PDB-style files is described here.)

Timeline for d3dx9d1: