Lineage for d1dn0b2 (1dn0 B:121-225)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1516238Protein Immunoglobulin heavy chain mu constant domain 1, CH1-mu [88582] (1 species)
  7. 1516239Species Human (Homo sapiens) [TaxId:9606] [88583] (7 PDB entries)
  8. 1516240Domain d1dn0b2: 1dn0 B:121-225 [20935]
    Other proteins in same PDB: d1dn0a1, d1dn0a2, d1dn0b1, d1dn0c1, d1dn0c2, d1dn0d1
    part of Fab Kau cold agglutinin IgM

Details for d1dn0b2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin
PDB Compounds: (B:) igm-kappa cold agglutinin (heavy chain)

SCOPe Domain Sequences for d1dn0b2:

Sequence, based on SEQRES records: (download)

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvscenspsdtssvavgclaqdflpdsitfswkyknnsdisstrgfpsvl
rggkyaatsqvllpskdvmagtdehvvckvqhpngnkeknvplpv

Sequence, based on observed residues (ATOM records): (download)

>d1dn0b2 b.1.1.2 (B:121-225) Immunoglobulin heavy chain mu constant domain 1, CH1-mu {Human (Homo sapiens) [TaxId: 9606]}
gsasaptlfplvsctssvavgclaqdflpdsitfswkyknnsdisstrgfpsvlrggkya
atsqvllpskdvtdehvvckvqhpngnkeknvplpv

SCOPe Domain Coordinates for d1dn0b2:

Click to download the PDB-style file with coordinates for d1dn0b2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0b2: