Lineage for d3dx9c2 (3dx9 C:126-215)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2751014Domain d3dx9c2: 3dx9 C:126-215 [209349]
    Other proteins in same PDB: d3dx9a1, d3dx9b1, d3dx9c1, d3dx9d1
    automated match to d2esvd2

Details for d3dx9c2

PDB Entry: 3dx9 (more details), 2.75 Å

PDB Description: Crystal Structure of the DM1 TCR at 2.75A
PDB Compounds: (C:) DM1 T cell receptor alpha chain

SCOPe Domain Sequences for d3dx9c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx9c2 b.1.1.2 (C:126-215) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffpsp

SCOPe Domain Coordinates for d3dx9c2:

Click to download the PDB-style file with coordinates for d3dx9c2.
(The format of our PDB-style files is described here.)

Timeline for d3dx9c2: