Lineage for d1dn0a2 (1dn0 A:108-215)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 159900Species Fab Kau cold agglutinin (human) IgM, kappa L chain [48985] (2 PDB entries)
  8. 159901Domain d1dn0a2: 1dn0 A:108-215 [20934]
    Other proteins in same PDB: d1dn0a1, d1dn0b1, d1dn0c1, d1dn0d1

Details for d1dn0a2

PDB Entry: 1dn0 (more details), 2.28 Å

PDB Description: structure of the fab fragment from a human igm cold agglutinin

SCOP Domain Sequences for d1dn0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dn0a2 b.1.1.2 (A:108-215) Immunoglobulin (constant domains of L and H chains) {Fab Kau cold agglutinin (human) IgM, kappa L chain}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1dn0a2:

Click to download the PDB-style file with coordinates for d1dn0a2.
(The format of our PDB-style files is described here.)

Timeline for d1dn0a2: