Lineage for d3dx1a3 (3dx1 A:523-1045)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2044543Fold b.30: Supersandwich [49993] (3 superfamilies)
    sandwich; 18 strands in 2 sheets
  4. 2044682Superfamily b.30.5: Galactose mutarotase-like [74650] (12 families) (S)
    probable carbohydrate-binding domain in enzymes acting on sugars
  5. 2045015Family b.30.5.6: alpha-mannosidase, C-terminal domain [88656] (2 protein domains)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
    the supersandwich domain is elaborated with additional beta-strands and beta-sandwich subdomains
  6. 2045016Protein Golgi alpha-mannosidase II [88657] (1 species)
  7. 2045017Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88658] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 2045023Domain d3dx1a3: 3dx1 A:523-1045 [209334]
    Other proteins in same PDB: d3dx1a1, d3dx1a2
    automated match to d1qwna2
    complexed with mrd, nag, po4, yho, zn

Details for d3dx1a3

PDB Entry: 3dx1 (more details), 1.21 Å

PDB Description: golgi alpha-mannosidase ii in complex with mannostatin analog (1s,2s, 3r,4r)-4-aminocyclopentane-1,2,3-triol
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3dx1a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx1a3 b.30.5.6 (A:523-1045) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
yftlddsrwpgsgvedsrttiilgedilpskhvvmhntlphwreqlvdfyvsspfvsvtd
lannpveaqvspvwswhhdtltktihpqgsttkyriifkarvppmglatyvltisdskpe
htsyasnlllrknptslplgqypedvkfgdpreislrvgngptlafseqgllksiqltqd
sphvpvhfkflkygvrshgdrsgaylflpngpaspvelgqpvvlvtkgklessvsvglps
vvhqtimrggapeirnlvdigsldnteivmrlethidsgdifytdlnglqfikrrrldkl
plqanyypipsgmfiedantrltlltgqplggsslasgeleimqdrrlasdderglgqgv
ldnkpvlhiyrlvlekvnncvrpsklhpagyltsaahkasqslldpldkfifaenewiga
qgqfggdhpsaredldvsvmrrltkssaktqrvgyvlhrtnlmqcgtpeehtqkldvchl
lpnvarcerttltflqnlehldgmvapevcpmetaayvsshss

SCOPe Domain Coordinates for d3dx1a3:

Click to download the PDB-style file with coordinates for d3dx1a3.
(The format of our PDB-style files is described here.)

Timeline for d3dx1a3: