Lineage for d3dx1a1 (3dx1 A:30-411)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1833668Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 1833746Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 1833747Family c.6.2.1: alpha-mannosidase [88714] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 1833748Protein Golgi alpha-mannosidase II [88715] (1 species)
  7. 1833749Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88716] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 1833755Domain d3dx1a1: 3dx1 A:30-411 [209332]
    Other proteins in same PDB: d3dx1a2, d3dx1a3
    automated match to d1qwna3
    complexed with mrd, nag, po4, yho, zn

Details for d3dx1a1

PDB Entry: 3dx1 (more details), 1.21 Å

PDB Description: golgi alpha-mannosidase ii in complex with mannostatin analog (1s,2s, 3r,4r)-4-aminocyclopentane-1,2,3-triol
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3dx1a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx1a1 c.6.2.1 (A:30-411) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
qcqdvvqdvpnvdvqmlelydrmsfkdidggvwkqgwnikydplkynahhklkvfvvphs
hndpgwiqtfeeyyqhdtkhilsnalrhlhdnpemkfiwaeisyfarfyhdlgenkklqm
ksivkngqlefvtggwvmpdeanshwrnvllqltegqtwlkqfmnvtptaswaidpfghs
ptmpyilqksgfknmliqrthysvkkelaqqrqleflwrqiwdnkgdtalfthmmpfysy
diphtcgpdpkvccqfdfkrmgsfglscpwkvpprtisdqnvaarsdllvdqwkkkaely
rtnvlliplgddfrfkqntewdvqrvnyerlfehinsqahfnvqaqfgtlqeyfdavhqa
eragqaefptlsgdfftyadrs

SCOPe Domain Coordinates for d3dx1a1:

Click to download the PDB-style file with coordinates for d3dx1a1.
(The format of our PDB-style files is described here.)

Timeline for d3dx1a1: