Lineage for d3dx0a2 (3dx0 A:412-522)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1724803Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 1724897Superfamily a.8.3: Families 57/38 glycoside transferase middle domain [88688] (4 families) (S)
  5. 1724898Family a.8.3.1: alpha-mannosidase, domain 2 [88693] (2 proteins)
    family 38 glycoside hydrolase; overall domain organization is similar to that of the 4-alpha-glucanotransferase family
  6. 1724899Protein Golgi alpha-mannosidase II [88694] (1 species)
  7. 1724900Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [88695] (57 PDB entries)
    Uniprot Q24451 94-1107
  8. 1724938Domain d3dx0a2: 3dx0 A:412-522 [209330]
    Other proteins in same PDB: d3dx0a1, d3dx0a3
    automated match to d1qwna1
    complexed with mpd, msn, nag, so4, zn

Details for d3dx0a2

PDB Entry: 3dx0 (more details), 1.7 Å

PDB Description: golgi alpha-mannosidase ii in complex with mannostatin a at ph 5.75
PDB Compounds: (A:) Alpha-mannosidase 2

SCOPe Domain Sequences for d3dx0a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dx0a2 a.8.3.1 (A:412-522) Golgi alpha-mannosidase II {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
dnywsgyytsrpyhkrmdrvlmhyvraaemlsawhswdgmarieerleqarrelslfqhh
dgitgtakthvvvdyeqrmqealkacqmvmqqsvyrlltkpsiyspdfsfs

SCOPe Domain Coordinates for d3dx0a2:

Click to download the PDB-style file with coordinates for d3dx0a2.
(The format of our PDB-style files is described here.)

Timeline for d3dx0a2: