SCOPe 2.08: Domain d3dwvb_: 3dwv B:

Lineage for d3dwvb_ (3dwv B:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [225474] (6 PDB entries)

8. Domain d3dwvb_: 3dwv B: [209328]
   automated match to d3e0ua_

Details for d3dwvb_

PDB Entry: 3dwv, 1.41 Å

PDB Description: glutathione peroxidase-type tryparedoxin peroxidase, oxidized form

PDB Compounds: (B:) glutathione peroxidase-like protein

SCOPe Domain Sequences for d3dwvb_:

Sequence; same for both SEQRES and ATOM records:

>d3dwvb_ c.47.1.0 (B:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
msaassifdfevldadhkpynlvqhkgsplliynvaskcgytkggyetattlynkyksqg
ftvlafpsnqfggqepgneeeikefvctkfkaefpimakinvngenahplyeymkktkpg
ilatkaikwnftsflidrdgvpverfspgasvkdieeklipll

Timeline for d3dwvb_:

• d3dwvb_ first appeared in SCOPe 2.03
  
• d3dwvb_ appears in SCOPe 2.07