Lineage for d3dv4b_ (3dv4 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024817Domain d3dv4b_: 3dv4 B: [209322]
    automated match to d1ar1c_
    complexed with kdo, mg, pg4

Details for d3dv4b_

PDB Entry: 3dv4 (more details), 1.95 Å

PDB Description: crystal structure of sag506-01, tetragonal, crystal 1
PDB Compounds: (B:) Ig-like protein

SCOPe Domain Sequences for d3dv4b_:

Sequence, based on SEQRES records: (download)

>d3dv4b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytv
eysasvkgrftisrdnsqsilylqmntlraedsatyycardgyyvdamdywgqgtsvtvs
s

Sequence, based on observed residues (ATOM records): (download)

>d3dv4b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evklvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytv
eysasvkgrftisrdnsqsilylqmntaedsatyycardgyyvdamdywgqgtsvtvss

SCOPe Domain Coordinates for d3dv4b_:

Click to download the PDB-style file with coordinates for d3dv4b_.
(The format of our PDB-style files is described here.)

Timeline for d3dv4b_: