![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein automated matches [190119] (18 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [186842] (133 PDB entries) |
![]() | Domain d3dv4a_: 3dv4 A: [209321] automated match to d1eeqa_ complexed with kdo, mg, pg4 |
PDB Entry: 3dv4 (more details), 1.95 Å
SCOPe Domain Sequences for d3dv4a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dv4a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} divltqspsslavsagervtmsckssqslfksrnqknylawyqqkpgqspklliywastr esgvpdrftgsgsgtdftltingvqaedlavyyckqsynlrtfgggtklelk
Timeline for d3dv4a_: