SCOPe 2.08: Domain d3dv4a_: 3dv4 A:

Lineage for d3dv4a_ (3dv4 A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (24 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (622 PDB entries)

8. Domain d3dv4a_: 3dv4 A: [209321]
   automated match to d1eeqa_
   complexed with kdo, mg, pg4

Details for d3dv4a_

PDB Entry: 3dv4, 1.95 Å

PDB Description: crystal structure of sag506-01, tetragonal, crystal 1

PDB Compounds: (A:) antibody Fv fragment SAG506-01

SCOPe Domain Sequences for d3dv4a_:

Sequence; same for both SEQRES and ATOM records:

>d3dv4a_ b.1.1.1 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspsslavsagervtmsckssqslfksrnqknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltingvqaedlavyyckqsynlrtfgggtklelk

Timeline for d3dv4a_:

• d3dv4a_ first appeared in SCOPe 2.03
  
• d3dv4a_ appears in SCOPe 2.07