Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein automated matches [190119] (22 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries) |
Domain d3durb_: 3dur B: [209310] automated match to d1ar1c_ complexed with kdo, mg, pg4 |
PDB Entry: 3dur (more details), 1.86 Å
SCOPe Domain Sequences for d3durb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3durb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} evqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt eysasvkgrfsisrdnsqsilylqmntlraedsatyycardgyyadamdywgqgtsvtvs s
Timeline for d3durb_: