SCOPe 2.06: Domain d3durb_: 3dur B:

Lineage for d3durb_ (3dur B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein automated matches [190119] (22 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)

8. Domain d3durb_: 3dur B: [209310]
   automated match to d1ar1c_
   complexed with kdo, mg, pg4

Details for d3durb_

PDB Entry: 3dur, 1.86 Å

PDB Description: crystal structure of sag173-04

PDB Compounds: (B:) Ig-like protein

SCOPe Domain Sequences for d3durb_:

Sequence; same for both SEQRES and ATOM records:

>d3durb_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evqlvesggglvqpggslrlscatsgftftdyymswvrqppgkalewlgfirnkakgytt
eysasvkgrfsisrdnsqsilylqmntlraedsatyycardgyyadamdywgqgtsvtvs
s

Timeline for d3durb_:

• d3durb_ first appeared in SCOPe 2.03
  
• d3durb_ appears in SCOPe 2.05
  
• d3durb_ appears in SCOPe 2.07
  
• d3durb_ appears in the current release, SCOPe 2.08