Lineage for d1igjd2 (1igj D:115-227)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 453267Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 453396Species Mouse (Mus musculus) [TaxId:10090] [88576] (295 PDB entries)
  8. 453583Domain d1igjd2: 1igj D:115-227 [20931]
    Other proteins in same PDB: d1igja1, d1igja2, d1igjb1, d1igjc1, d1igjc2, d1igjd1
    part of Fab 26-10

Details for d1igjd2

PDB Entry: 1igj (more details), 2.5 Å

PDB Description: 26-10 fab:digoxin complex-affinity and specificity due to surface complementarity

SCOP Domain Sequences for d1igjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igjd2 b.1.1.2 (D:115-227) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOP Domain Coordinates for d1igjd2:

Click to download the PDB-style file with coordinates for d1igjd2.
(The format of our PDB-style files is described here.)

Timeline for d1igjd2: