Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.3: Acetylhydrolase [52273] (3 proteins) |
Protein automated matches [227002] (1 species) not a true protein |
Species Cow (Bos taurus) [TaxId:9913] [225659] (3 PDB entries) |
Domain d3dt9a_: 3dt9 A: [209302] automated match to d1waba_ complexed with gd7 |
PDB Entry: 3dt9 (more details), 1.85 Å
SCOPe Domain Sequences for d3dt9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dt9a_ c.23.10.3 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]} enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqseiwrelfsp lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt ishhdmydylhlsrlgytpvcralhslllrll
Timeline for d3dt9a_: