Lineage for d3dt9a_ (3dt9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857391Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)
  6. 2857418Protein automated matches [227002] (1 species)
    not a true protein
  7. 2857419Species Cow (Bos taurus) [TaxId:9913] [225659] (3 PDB entries)
  8. 2857420Domain d3dt9a_: 3dt9 A: [209302]
    automated match to d1waba_
    complexed with gd7

Details for d3dt9a_

PDB Entry: 3dt9 (more details), 1.85 Å

PDB Description: crystal structure of bovin brain platelet activating factor acetylhydrolase covalently inhibited by soman
PDB Compounds: (A:) Brain Platelet-activating factor acetylhydrolase IB subunit alpha

SCOPe Domain Sequences for d3dt9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dt9a_ c.23.10.3 (A:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqseiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrll

SCOPe Domain Coordinates for d3dt9a_:

Click to download the PDB-style file with coordinates for d3dt9a_.
(The format of our PDB-style files is described here.)

Timeline for d3dt9a_: