| Class b: All beta proteins [48724] (141 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins) |
| Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
| Species Mouse (Mus musculus) [TaxId:10090] [88567] (270 PDB entries) |
| Domain d1igjc2: 1igj C:108-211 [20930] Other proteins in same PDB: d1igja1, d1igjb1, d1igjb2, d1igjc1, d1igjd1, d1igjd2 part of Fab 26-10 complexed with dgx |
PDB Entry: 1igj (more details), 2.5 Å
SCOP Domain Sequences for d1igjc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igjc2 b.1.1.2 (C:108-211) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnr
Timeline for d1igjc2: