Lineage for d3ds5a_ (3ds5 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316654Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2316655Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 protein domains)
  6. 2316661Protein HIV capsid protein, dimerisation domain [47359] (2 species)
  7. 2316665Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (15 PDB entries)
  8. 2316678Domain d3ds5a_: 3ds5 A: [209285]
    automated match to d1baja_
    mutant

Details for d3ds5a_

PDB Entry: 3ds5 (more details), 2.4 Å

PDB Description: hiv-1 capsid c-terminal domain mutant (n183a)
PDB Compounds: (A:) hiv-1 capsid protein

SCOPe Domain Sequences for d3ds5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ds5a_ a.28.3.1 (A:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
sildirqgpkepfrdyvdrfyktlraeqasqevkawmtetllvqnanpdcktilkalgpg
atleemmtacqgv

SCOPe Domain Coordinates for d3ds5a_:

Click to download the PDB-style file with coordinates for d3ds5a_.
(The format of our PDB-style files is described here.)

Timeline for d3ds5a_: