SCOPe 2.03: Domain d3ds2b_: 3ds2 B:

Lineage for d3ds2b_ (3ds2 B:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins)

6. Protein HIV capsid protein, dimerisation domain [47359] (1 species)

7. Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (11 PDB entries)

8. Domain d3ds2b_: 3ds2 B: [209284]
   automated match to d1baja_
   mutant

Details for d3ds2b_

PDB Entry: 3ds2, 1.2 Å

PDB Description: hiv-1 capsid c-terminal domain mutant (y169a)

PDB Compounds: (B:) hiv-1 capsid protein

SCOPe Domain Sequences for d3ds2b_:

Sequence; same for both SEQRES and ATOM records:

>d3ds2b_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfaktlraeqasqevknwmtetllvqnanpdcktilkalgp
gatleemmtacqgvggpghkarvl

Timeline for d3ds2b_:

• d3ds2b_ is new in SCOPe 2.03-stable
  
• d3ds2b_ appears in SCOPe 2.04
  
• d3ds2b_ appears in the current release, SCOPe 2.08