![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
![]() | Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) ![]() |
![]() | Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 proteins) |
![]() | Protein HIV capsid protein, dimerisation domain [47359] (3 species) |
![]() | Species Human immunodeficiency virus 1 [TaxId:11676] [361175] (4 PDB entries) |
![]() | Domain d3ds2b_: 3ds2 B: [209284] automated match to d1baja_ mutant |
PDB Entry: 3ds2 (more details), 1.2 Å
SCOPe Domain Sequences for d3ds2b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ds2b_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus 1 [TaxId: 11676]} tsildirqgpkepfrdyvdrfaktlraeqasqevknwmtetllvqnanpdcktilkalgp gatleemmtacqgvggpghkarvl
Timeline for d3ds2b_: