Lineage for d3drwb_ (3drw B:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1385058Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 1385059Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 1385179Family c.72.1.3: ADP-specific Phosphofructokinase/Glucokinase [64147] (3 proteins)
    Pfam PF04587
  6. 1385190Protein automated matches [226988] (1 species)
    not a true protein
  7. 1385191Species Pyrococcus horikoshii [TaxId:53953] [225568] (1 PDB entry)
  8. 1385193Domain d3drwb_: 3drw B: [209282]
    automated match to d1u2xa_
    complexed with amp, na

Details for d3drwb_

PDB Entry: 3drw (more details), 1.9 Å

PDB Description: crystal structure of a phosphofructokinase from pyrococcus horikoshii ot3 with amp
PDB Compounds: (B:) ADP-specific phosphofructokinase

SCOPe Domain Sequences for d3drwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3drwb_ c.72.1.3 (B:) automated matches {Pyrococcus horikoshii [TaxId: 53953]}
mipehlsiytaynaniaaivklnqetiqnlinafdpdevkrrieeypreinepidfvarl
vhtlklgkpaavplvnekmnewfdktfryeeerlggqagiiantlaglkirkviaytpfl
pkrlaelfkkgvlypvvengelqfkpiqeayregdplkinrifefrkglkfklgdetiei
pnsgrfivsarfesisrietredikpflgeigkevdgaifsgyqglrtkysdgkdanyyl
rrakediiefkekdvkihvefasvqdrklrkkiitnilpfvdsvgideaeiaqilsvlgy
reladriftynrledsilggmiildelnfeilqvhttyylmyithrdnplseeelaksle
fgttlaaaraslgdirgpddykvglkvpfnerseyvklrfeeaksrlrmreykvvviptr
lvqnpvltvglgdtisagafltyleflkrh

SCOPe Domain Coordinates for d3drwb_:

Click to download the PDB-style file with coordinates for d3drwb_.
(The format of our PDB-style files is described here.)

Timeline for d3drwb_: