SCOPe 2.08: Domain d3dreb1: 3dre B:5-102

Lineage for d3dreb1 (3dre B:5-102)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)

8. Domain d3dreb1: 3dre B:5-102 [209278]
   Other proteins in same PDB: d3drea2, d3dreb2
   automated match to d1g0wa1

Details for d3dreb1

PDB Entry: 3dre, 2.2 Å

PDB Description: crystal structure of human brain-type creatine kinase

PDB Compounds: (B:) Creatine kinase B-type

SCOPe Domain Sequences for d3dreb1:

Sequence; same for both SEQRES and ATOM records:

>d3dreb1 a.83.1.0 (B:5-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
nshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdnp
ghpyimtvgcvagdeesyevfkdlfdpiiedrhggykp

Timeline for d3dreb1:

• d3dreb1 first appeared in SCOPe 2.03
  
• d3dreb1 appears in SCOPe 2.07