SCOPe 2.04: Domain d3drea1: 3dre A:4-102

Lineage for d3drea1 (3dre A:4-102)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)

8. Domain d3drea1: 3dre A:4-102 [209276]
   Other proteins in same PDB: d3drea2, d3dreb2
   automated match to d1g0wa1

Details for d3drea1

PDB Entry: 3dre, 2.2 Å

PDB Description: crystal structure of human brain-type creatine kinase

PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d3drea1:

Sequence; same for both SEQRES and ATOM records:

>d3drea1 a.83.1.0 (A:4-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdn
pghpyimtvgcvagdeesyevfkdlfdpiiedrhggykp

Timeline for d3drea1:

• d3drea1 first appeared in SCOPe 2.03
  
• d3drea1 appears in SCOPe 2.05
  
• d3drea1 appears in the current release, SCOPe 2.08