Lineage for d3drea1 (3dre A:4-102)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1274810Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
    irregular array of 6 short helices
  4. 1274811Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) (S)
    automatically mapped to Pfam PF02807
  5. 1274870Family a.83.1.0: automated matches [227170] (1 protein)
    not a true family
  6. 1274871Protein automated matches [226884] (5 species)
    not a true protein
  7. 1274872Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)
  8. 1274877Domain d3drea1: 3dre A:4-102 [209276]
    Other proteins in same PDB: d3drea2, d3dreb2
    automated match to d1g0wa1

Details for d3drea1

PDB Entry: 3dre (more details), 2.2 Å

PDB Description: crystal structure of human brain-type creatine kinase
PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d3drea1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3drea1 a.83.1.0 (A:4-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
snshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdn
pghpyimtvgcvagdeesyevfkdlfdpiiedrhggykp

SCOPe Domain Coordinates for d3drea1:

Click to download the PDB-style file with coordinates for d3drea1.
(The format of our PDB-style files is described here.)

Timeline for d3drea1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3drea2