![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily) irregular array of 6 short helices |
![]() | Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families) ![]() automatically mapped to Pfam PF02807 |
![]() | Family a.83.1.0: automated matches [227170] (1 protein) not a true family |
![]() | Protein automated matches [226884] (9 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries) |
![]() | Domain d3drea1: 3dre A:4-102 [209276] Other proteins in same PDB: d3drea2, d3dreb2 automated match to d1g0wa1 |
PDB Entry: 3dre (more details), 2.2 Å
SCOPe Domain Sequences for d3drea1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3drea1 a.83.1.0 (A:4-102) automated matches {Human (Homo sapiens) [TaxId: 9606]} snshnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdn pghpyimtvgcvagdeesyevfkdlfdpiiedrhggykp
Timeline for d3drea1: