Lineage for d3drbb2 (3drb B:103-381)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2214217Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2214218Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2214351Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2214415Protein automated matches [226885] (5 species)
    not a true protein
  7. 2214419Species Human (Homo sapiens) [TaxId:9606] [225066] (4 PDB entries)
  8. 2214423Domain d3drbb2: 3drb B:103-381 [209275]
    Other proteins in same PDB: d3drba1, d3drbb1
    automated match to d1g0wa2
    complexed with adp, mg

Details for d3drbb2

PDB Entry: 3drb (more details), 2 Å

PDB Description: crystal structure of human brain-type creatine kinase
PDB Compounds: (B:) Creatine kinase B-type

SCOPe Domain Sequences for d3drbb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3drbb2 d.128.1.2 (B:103-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwvneedhlrvismqkggnmkevftrfctgltqietlfkskdyefmwnphlgyilt
cpsnlgtglragvhiklpnlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk

SCOPe Domain Coordinates for d3drbb2:

Click to download the PDB-style file with coordinates for d3drbb2.
(The format of our PDB-style files is described here.)

Timeline for d3drbb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3drbb1