Lineage for d3drba2 (3drb A:103-381)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538320Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
    duplication: common core consists of two beta-alpha-beta2-alpha repeats
  4. 2538321Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families) (S)
  5. 2538454Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
    automatically mapped to Pfam PF00217
  6. 2538518Protein automated matches [226885] (5 species)
    not a true protein
  7. 2538522Species Human (Homo sapiens) [TaxId:9606] [225066] (4 PDB entries)
  8. 2538525Domain d3drba2: 3drb A:103-381 [209273]
    Other proteins in same PDB: d3drba1, d3drbb1
    automated match to d1g0wa2
    complexed with adp, mg

Details for d3drba2

PDB Entry: 3drb (more details), 2 Å

PDB Description: crystal structure of human brain-type creatine kinase
PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d3drba2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3drba2 d.128.1.2 (A:103-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwvneedhlrvismqkggnmkevftrfctgltqietlfkskdyefmwnphlgyilt
cpsnlgtglragvhiklpnlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk

SCOPe Domain Coordinates for d3drba2:

Click to download the PDB-style file with coordinates for d3drba2.
(The format of our PDB-style files is described here.)

Timeline for d3drba2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3drba1