SCOPe 2.08: Domain d3drba1: 3drb A:6-102

Lineage for d3drba1 (3drb A:6-102)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.83: Guanido kinase N-terminal domain [48033] (1 superfamily)
   irregular array of 6 short helices

4. Superfamily a.83.1: Guanido kinase N-terminal domain [48034] (2 families)
   automatically mapped to Pfam PF02807

5. Family a.83.1.0: automated matches [227170] (1 protein)
   not a true family

6. Protein automated matches [226884] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225065] (4 PDB entries)

8. Domain d3drba1: 3drb A:6-102 [209272]
   Other proteins in same PDB: d3drba2, d3drbb2
   automated match to d1g0wa1
   complexed with adp, mg

Details for d3drba1

PDB Entry: 3drb, 2 Å

PDB Description: crystal structure of human brain-type creatine kinase

PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d3drba1:

Sequence; same for both SEQRES and ATOM records:

>d3drba1 a.83.1.0 (A:6-102) automated matches {Human (Homo sapiens) [TaxId: 9606]}
shnalklrfpaedefpdlsahnnhmakvltpelyaelrakstpsgftlddviqtgvdnpg
hpyimtvgcvagdeesyevfkdlfdpiiedrhggykp

Timeline for d3drba1:

• d3drba1 first appeared in SCOPe 2.03
  
• d3drba1 appears in SCOPe 2.07