SCOPe 2.03: Domain d3dr7c_: 3dr7 C:

Lineage for d3dr7c_ (3dr7 C:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
   main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest

4. Superfamily c.67.1: PLP-dependent transferases [53383] (10 families)

5. Family c.67.1.0: automated matches [191328] (1 protein)
   not a true family

6. Protein automated matches [190151] (66 species)
   not a true protein

7. Species Caulobacter crescentus [TaxId:190650] [188372] (3 PDB entries)

8. Domain d3dr7c_: 3dr7 C: [209270]
   automated match to d3bn1c_
   complexed with edo, gpd

Details for d3dr7c_

PDB Entry: 3dr7, 1.7 Å

PDB Description: gdp-perosamine synthase from caulobacter crescentus with bound gdp-3- deoxyperosamine

PDB Compounds: (C:) Putative perosamine synthetase

SCOPe Domain Sequences for d3dr7c_:

Sequence; same for both SEQRES and ATOM records:

>d3dr7c_ c.67.1.0 (C:) automated matches {Caulobacter crescentus [TaxId: 190650]}
prisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngttal
hlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitpr
tkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsffg
nkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaql
ervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvi
kdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvia
aldqvlv

Timeline for d3dr7c_:

• d3dr7c_ is new in SCOPe 2.03-stable
  
• d3dr7c_ appears in SCOPe 2.04
  
• d3dr7c_ appears in the current release, SCOPe 2.08, called d3dr7c1