Lineage for d2igfh2 (2igf H:114-233)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 8826Species Fab B13I2 (mouse), kappa L chain [48983] (2 PDB entries)
  8. 8831Domain d2igfh2: 2igf H:114-233 [20927]
    Other proteins in same PDB: d2igfh1, d2igfl1

Details for d2igfh2

PDB Entry: 2igf (more details), 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d2igfh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2igfh2 b.1.1.2 (H:114-233) Immunoglobulin (constant domains of L and H chains) {Fab B13I2 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d2igfh2:

Click to download the PDB-style file with coordinates for d2igfh2.
(The format of our PDB-style files is described here.)

Timeline for d2igfh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2igfh1