Lineage for d3dr7b1 (3dr7 B:26-371)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2895166Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 2895167Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 2896671Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 2896672Protein automated matches [190151] (166 species)
    not a true protein
  7. 2896919Species Caulobacter crescentus [TaxId:190650] [188372] (3 PDB entries)
  8. 2896925Domain d3dr7b1: 3dr7 B:26-371 [209269]
    Other proteins in same PDB: d3dr7a2, d3dr7b2, d3dr7c2, d3dr7d2
    automated match to d3bn1c_
    complexed with edo, gpd

Details for d3dr7b1

PDB Entry: 3dr7 (more details), 1.7 Å

PDB Description: gdp-perosamine synthase from caulobacter crescentus with bound gdp-3- deoxyperosamine
PDB Compounds: (B:) Putative perosamine synthetase

SCOPe Domain Sequences for d3dr7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dr7b1 c.67.1.0 (B:26-371) automated matches {Caulobacter crescentus [TaxId: 190650]}
mdttwissvgrfivefekafadycgvkhaiacnngttalhlalvamgigpgdevivpslt
yiasansvtycgatpvlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpile
varrhnllviedaaeavgatyrgkksgslgdcatfsffgnkiittgeggmittndddlaa
kmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqkl
arlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimp
pyahlatddlkiaeacgvdglnlpthaglteadidrviaaldqvlv

SCOPe Domain Coordinates for d3dr7b1:

Click to download the PDB-style file with coordinates for d3dr7b1.
(The format of our PDB-style files is described here.)

Timeline for d3dr7b1: