Lineage for d3dr7a_ (3dr7 A:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1613158Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1613159Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1614338Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1614339Protein automated matches [190151] (83 species)
    not a true protein
  7. 1614468Species Caulobacter crescentus [TaxId:190650] [188372] (3 PDB entries)
  8. 1614473Domain d3dr7a_: 3dr7 A: [209268]
    automated match to d3bn1c_
    complexed with edo, gpd

Details for d3dr7a_

PDB Entry: 3dr7 (more details), 1.7 Å

PDB Description: gdp-perosamine synthase from caulobacter crescentus with bound gdp-3- deoxyperosamine
PDB Compounds: (A:) Putative perosamine synthetase

SCOPe Domain Sequences for d3dr7a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dr7a_ c.67.1.0 (A:) automated matches {Caulobacter crescentus [TaxId: 190650]}
lprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngtta
lhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitp
rtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsff
gnkiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaq
lervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqv
ikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvi
aaldqvlv

SCOPe Domain Coordinates for d3dr7a_:

Click to download the PDB-style file with coordinates for d3dr7a_.
(The format of our PDB-style files is described here.)

Timeline for d3dr7a_: