Lineage for d3dr4c_ (3dr4 C:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1379866Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies)
    main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest
  4. 1379867Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) (S)
  5. 1380996Family c.67.1.0: automated matches [191328] (1 protein)
    not a true family
  6. 1380997Protein automated matches [190151] (66 species)
    not a true protein
  7. 1381074Species Caulobacter crescentus [TaxId:190650] [188372] (3 PDB entries)
  8. 1381077Domain d3dr4c_: 3dr4 C: [209266]
    automated match to d3bn1c_
    complexed with edo, g4m; mutant

Details for d3dr4c_

PDB Entry: 3dr4 (more details), 1.6 Å

PDB Description: GDP-perosamine synthase K186A mutant from Caulobacter crescentus with bound sugar ligand
PDB Compounds: (C:) Putative perosamine synthetase

SCOPe Domain Sequences for d3dr4c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dr4c_ c.67.1.0 (C:) automated matches {Caulobacter crescentus [TaxId: 190650]}
lprisvaaprldgnerdyvlecmdttwissvgrfivefekafadycgvkhaiacnngtta
lhlalvamgigpgdevivpsltyiasansvtycgatpvlvdndprtfnldaaklealitp
rtkaimpvhlygqicdmdpilevarrhnllviedaaeavgatyrgkksgslgdcatfsff
gnaiittgeggmittndddlaakmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaq
lervdehlaarervvgwyeqklarlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqv
ikdldalgiesrpvfhpmhimppyahlatddlkiaeacgvdglnlpthaglteadidrvi
aaldqvlv

SCOPe Domain Coordinates for d3dr4c_:

Click to download the PDB-style file with coordinates for d3dr4c_.
(The format of our PDB-style files is described here.)

Timeline for d3dr4c_: