![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.67: PLP-dependent transferase-like [53382] (3 superfamilies) main domain: 3 layers: a/b/a, mixed beta-sheet of 7 strands, order 3245671; strand 7 is antiparallel to the rest |
![]() | Superfamily c.67.1: PLP-dependent transferases [53383] (10 families) ![]() |
![]() | Family c.67.1.0: automated matches [191328] (1 protein) not a true family |
![]() | Protein automated matches [190151] (166 species) not a true protein |
![]() | Species Caulobacter crescentus [TaxId:190650] [188372] (3 PDB entries) |
![]() | Domain d3dr4c1: 3dr4 C:26-371 [209266] Other proteins in same PDB: d3dr4a2, d3dr4b2, d3dr4c2, d3dr4d2 automated match to d3bn1c_ complexed with edo, g4m; mutant |
PDB Entry: 3dr4 (more details), 1.6 Å
SCOPe Domain Sequences for d3dr4c1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dr4c1 c.67.1.0 (C:26-371) automated matches {Caulobacter crescentus [TaxId: 190650]} mdttwissvgrfivefekafadycgvkhaiacnngttalhlalvamgigpgdevivpslt yiasansvtycgatpvlvdndprtfnldaaklealitprtkaimpvhlygqicdmdpile varrhnllviedaaeavgatyrgkksgslgdcatfsffgnaiittgeggmittndddlaa kmrllrgqgmdpnrrywfpivgfnyrmtniqaaiglaqlervdehlaarervvgwyeqkl arlgnrvtkphvaltgrhvfwmytvrlgeglsttrdqvikdldalgiesrpvfhpmhimp pyahlatddlkiaeacgvdglnlpthaglteadidrviaaldqvlv
Timeline for d3dr4c1: