SCOP 1.71: Domain d2igfl2: 2igf L:108-214

Lineage for d2igfl2 (2igf L:108-214)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries)

8. Domain d2igfl2: 2igf L:108-214 [20926]
   Other proteins in same PDB: d2igfh1, d2igfh2, d2igfl1
   part of Fab B13I2
   complexed with nag

Details for d2igfl2

PDB Entry: 2igf, 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

SCOP Domain Sequences for d2igfl2:

Sequence; same for both SEQRES and ATOM records:

>d2igfl2 b.1.1.2 (L:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d2igfl2:

• d2igfl2 first appeared (with stable ids) in SCOP 1.55
  
• d2igfl2 appears in SCOP 1.69
  
• d2igfl2 appears in SCOP 1.73
  
• d2igfl2 appears in the current release, SCOPe 2.07