SCOPe 2.07: Domain d3dq0a1: 3dq0 A:32-245

Lineage for d3dq0a1 (3dq0 A:32-245)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.145: FAD-binding/transporter-associated domain-like [56175] (1 superfamily)
   consists of two alpha+beta subdomains

4. Superfamily d.145.1: FAD-binding/transporter-associated domain-like [56176] (5 families)

5. Family d.145.1.0: automated matches [191624] (1 protein)
   not a true family

6. Protein automated matches [191143] (12 species)
   not a true protein

7. Species Maize (Zea mays) [TaxId:4577] [225479] (20 PDB entries)

8. Domain d3dq0a1: 3dq0 A:32-245 [209256]
   Other proteins in same PDB: d3dq0a2
   automated match to d1w1oa2
   complexed with fad, mzo, nag

Details for d3dq0a1

PDB Entry: 3dq0, 1.9 Å

PDB Description: maize cytokinin oxidase/dehydrogenase complexed with n6-(3-methoxy- phenyl)adenine

PDB Compounds: (A:) cytokinin dehydrogenase 1

SCOPe Domain Sequences for d3dq0a1:

Sequence; same for both SEQRES and ATOM records:

>d3dq0a1 d.145.1.0 (A:32-245) automated matches {Maize (Zea mays) [TaxId: 4577]}
rpwpaslaalaldgklrtdsnataaastdfgnitsalpaavlypsstadlvallsaanst
pgwpytiafrgrghslmgqafapggvvvnmaslgdaaapprinvsadgryvdaggeqvwi
dvlraslargvaprswtdylyltvggtlsnagisgqafrhgpqisnvlemdvitghgemv
tcskqlnadlfdavlgglgqfgvitrariavepa

Timeline for d3dq0a1:

• d3dq0a1 first appeared in SCOPe 2.03
  
• d3dq0a1 appears in SCOPe 2.06
  
• d3dq0a1 appears in the current release, SCOPe 2.08