Lineage for d3dphb_ (3dph B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2316392Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 2316654Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 2316655Family a.28.3.1: Retrovirus capsid protein C-terminal domain [47354] (5 protein domains)
  6. 2316661Protein HIV capsid protein, dimerisation domain [47359] (2 species)
  7. 2316665Species Human immunodeficiency virus type 1 [TaxId:11676] [47360] (15 PDB entries)
  8. 2316674Domain d3dphb_: 3dph B: [209255]
    automated match to d1baja_
    mutant

Details for d3dphb_

PDB Entry: 3dph (more details), 2.01 Å

PDB Description: hiv-1 capsid c-terminal domain mutant (l211s)
PDB Compounds: (B:) hiv-1 capsid protein

SCOPe Domain Sequences for d3dphb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dphb_ a.28.3.1 (B:) HIV capsid protein, dimerisation domain {Human immunodeficiency virus type 1 [TaxId: 11676]}
ptsildirqgpkepfrdyvdrfyktlraeqasqevknwmtetllvqnanpdcktilkalg
pgatseemmtacqgvggpgh

SCOPe Domain Coordinates for d3dphb_:

Click to download the PDB-style file with coordinates for d3dphb_.
(The format of our PDB-style files is described here.)

Timeline for d3dphb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dpha_