![]() | Class b: All beta proteins [48724] (93 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
![]() | Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species) |
![]() | Species Fab B13I2 (mouse), kappa L chain [48983] (2 PDB entries) |
![]() | Domain d1igfj2: 1igf J:114-227 [20925] Other proteins in same PDB: d1igfh1, d1igfj1, d1igfl1, d1igfm1 |
PDB Entry: 1igf (more details), 2.8 Å
SCOP Domain Sequences for d1igfj2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igfj2 b.1.1.2 (J:114-227) Immunoglobulin (constant domains of L and H chains) {Fab B13I2 (mouse), kappa L chain} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp
Timeline for d1igfj2: