SCOP 1.55: Domain d1igfj2: 1igf J:114-227

Lineage for d1igfj2 (1igf J:114-227)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Fab B13I2 (mouse), kappa L chain [48983] (2 PDB entries)

8. Domain d1igfj2: 1igf J:114-227 [20925]
   Other proteins in same PDB: d1igfh1, d1igfj1, d1igfl1, d1igfm1

Details for d1igfj2

PDB Entry: 1igf, 2.8 Å

PDB Description: crystal structures of an antibody to a peptide and its complex with peptide antigen at 2.8 angstroms

PDB Compounds: (J:)

SCOP Domain Sequences for d1igfj2:

Sequence; same for both SEQRES and ATOM records:

>d1igfj2 b.1.1.2 (J:114-227) Immunoglobulin (constant domains of L and H chains) {Fab B13I2 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivp

Timeline for d1igfj2:

• d1igfj2 appears in SCOP 1.57
  
• d1igfj2 appears in the current release, SCOPe 2.07