Lineage for d3dona2 (3don A:100-269)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2449371Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2449372Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2453552Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
    extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site
  6. 2453800Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)
  7. 2453831Species Staphylococcus epidermidis [TaxId:176279] [225658] (2 PDB entries)
  8. 2453832Domain d3dona2: 3don A:100-269 [209245]
    Other proteins in same PDB: d3dona1, d3dona3
    automated match to d1p77a1
    complexed with gol

Details for d3dona2

PDB Entry: 3don (more details), 2.1 Å

PDB Description: Crystal structure of shikimate dehydrogenase from Staphylococcus epidermidis
PDB Compounds: (A:) Shikimate dehydrogenase

SCOPe Domain Sequences for d3dona2:

Sequence, based on SEQRES records: (download)

>d3dona2 c.2.1.7 (A:100-269) Shikimate 5-dehydrogenase AroE {Staphylococcus epidermidis [TaxId: 176279]}
dgigyvnglkqiyegiedayililgaggaskgianelykivrptltvanrtmsrfnnwsl
ninkinlshaeshldefdiiinttpagmngntdsvislnrlashtlvsdivynpyktpil
ieaeqrgnpiyngldmfvhqgaesfkiwtnlepdikamkniviqklkgel

Sequence, based on observed residues (ATOM records): (download)

>d3dona2 c.2.1.7 (A:100-269) Shikimate 5-dehydrogenase AroE {Staphylococcus epidermidis [TaxId: 176279]}
dgigyvnglkqiyegiedayililgaggaskgianelykivrptltvanrtmsrfnnwsl
ninkinlshaeshldefdiiinttpdsvislnrlashtlvsdivynpyktpilieaeqrg
npiyngldmfvhqgaesfkiwtnlepdikamkniviqklkgel

SCOPe Domain Coordinates for d3dona2:

Click to download the PDB-style file with coordinates for d3dona2.
(The format of our PDB-style files is described here.)

Timeline for d3dona2: