| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.56: CcmK-like [143414] (2 families) ![]() contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape |
| Family d.58.56.1: CcmK-like [143415] (4 proteins) Pfam PF00936; BMC domain |
| Protein automated matches [191074] (7 species) not a true protein |
| Species Synechocystis sp. [TaxId:1148] [226775] (2 PDB entries) |
| Domain d3dn9a_: 3dn9 A: [209237] Other proteins in same PDB: d3dn9b2, d3dn9d2, d3dn9f2 automated match to d3ssra_ complexed with so4; mutant |
PDB Entry: 3dn9 (more details), 2.28 Å
SCOPe Domain Sequences for d3dn9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dn9a_ d.58.56.1 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
iavgmietlgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlp
Timeline for d3dn9a_: