Lineage for d3dn9a_ (3dn9 A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2955934Superfamily d.58.56: CcmK-like [143414] (2 families) (S)
    contains extra C-terminal helix; forms compact hexameric 'tiles' of hexagonal shape
  5. 2955935Family d.58.56.1: CcmK-like [143415] (4 proteins)
    Pfam PF00936; BMC domain
  6. 2955969Protein automated matches [191074] (7 species)
    not a true protein
  7. 2956000Species Synechocystis sp. [TaxId:1148] [226775] (2 PDB entries)
  8. 2956002Domain d3dn9a_: 3dn9 A: [209237]
    Other proteins in same PDB: d3dn9b2, d3dn9d2, d3dn9f2
    automated match to d3ssra_
    complexed with so4; mutant

Details for d3dn9a_

PDB Entry: 3dn9 (more details), 2.28 Å

PDB Description: carboxysome subunit, ccmk1 c-terminal deletion mutant
PDB Compounds: (A:) CcmK1 C-terminal deletion mutant

SCOPe Domain Sequences for d3dn9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dn9a_ d.58.56.1 (A:) automated matches {Synechocystis sp. [TaxId: 1148]}
iavgmietlgfpavveaadsmvkaarvtlvgyekigsgrvtvivrgdvsevqasvtagie
nirrvnggevlsnhiiarphenleyvlp

SCOPe Domain Coordinates for d3dn9a_:

Click to download the PDB-style file with coordinates for d3dn9a_.
(The format of our PDB-style files is described here.)

Timeline for d3dn9a_: