Lineage for d3dlxb1 (3dlx B:40-285)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2922305Fold c.124: NagB/RpiA/CoA transferase-like [100949] (1 superfamily)
    core: 3 layers: a/b/a; parallel or mixed beta-sheet of 6 strands, order 321456
  4. 2922306Superfamily c.124.1: NagB/RpiA/CoA transferase-like [100950] (9 families) (S)
  5. 2922354Family c.124.1.2: CoA transferase alpha subunit-like [74656] (7 proteins)
    parallel beta-sheet of 7 strands, order 4321567
  6. 2922389Protein Succinate:CoA transferase, N-terminal domain [82464] (2 species)
  7. 2922390Species Human (Homo sapiens) [TaxId:9606] [225513] (1 PDB entry)
  8. 2922392Domain d3dlxb1: 3dlx B:40-285 [209228]
    Other proteins in same PDB: d3dlxa2, d3dlxb2, d3dlxc2, d3dlxd2
    automated match to d1ooyb2
    complexed with gol

Details for d3dlxb1

PDB Entry: 3dlx (more details), 2.2 Å

PDB Description: crystal structure of human 3-oxoacid coa transferase 1
PDB Compounds: (B:) Succinyl-CoA:3-ketoacid-coenzyme A transferase 1

SCOPe Domain Sequences for d3dlxb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dlxb1 c.124.1.2 (B:40-285) Succinate:CoA transferase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
tkfytdpveavkdipdgatvlvggfglcgipenlidallktgvkgltavsnnagvdnfgl
glllrskqikrmvssyvgenaeferqylsgeleveltpqgtlaeriraggagvpafytpt
gygtlvqeggspikynkdgsvaiaskprevrefngqhfileeaitgdfalvkawkadrag
nvifrksarnfnlpmckaaettvveveeivdigafapedihipqiyvhrlikgekyekri
erlsir

SCOPe Domain Coordinates for d3dlxb1:

Click to download the PDB-style file with coordinates for d3dlxb1.
(The format of our PDB-style files is described here.)

Timeline for d3dlxb1: