SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3dl2b1 (3dl2 B:171-318)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2090218Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2090219Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2094257Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2094258Protein automated matches [190069] (220 species)
    not a true protein
  7. 2095073Species Human (Homo sapiens) [TaxId:9606] [186944] (40 PDB entries)
  8. 2095104Domain d3dl2b1: 3dl2 B:171-318 [209224]
    Other proteins in same PDB: d3dl2a2, d3dl2a3, d3dl2b2, d3dl2b3
    automated match to d1ez4a1
    complexed with na, po4

Details for d3dl2b1

PDB Entry: 3dl2 (more details), 2.1 Å

PDB Description: Hexagonal structure of the LDH domain of Human Ubiquitin-conjugating Enzyme E2-like Isoform A
PDB Compounds: (B:) Ubiquitin-conjugating enzyme E2 variant 3

SCOPe Domain Sequences for d3dl2b1:

Sequence, based on SEQRES records: (download)

>d3dl2b1 c.2.1.0 (B:171-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
skswanhenktvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifn
lpnveiskdlsasahskvviftvnslgssqsyldvvqsnvdmfralvpalghysqhsvll
vasqpveimtyvtwklstfpanrvigig

Sequence, based on observed residues (ATOM records): (download)

>d3dl2b1 c.2.1.0 (B:171-318) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sksvnkitvvgggelgiactlaisakgiadrlvlldlsegtkgatmdleifnlpnveisk
dlsasahskvviftvnsqsyldvvqsnvdmfralvpalghysqhsvllvasqpveimtyv
twklstfpanrvigig

SCOPe Domain Coordinates for d3dl2b1:

Click to download the PDB-style file with coordinates for d3dl2b1.
(The format of our PDB-style files is described here.)

Timeline for d3dl2b1: