SCOPe 2.05: Domain d3dkzb_: 3dkz B:

Lineage for d3dkzb_ (3dkz B:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
   core: beta-alpha-beta(4); 2 layers: alpha/beta

4. Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families)

5. Family d.38.1.0: automated matches [191325] (1 protein)
   not a true family

6. Protein automated matches [190143] (32 species)
   not a true protein

7. Species Bordetella parapertussis [TaxId:519] [225507] (1 PDB entry)

8. Domain d3dkzb_: 3dkz B: [209221]
   automated match to d1zkib_

Details for d3dkzb_

PDB Entry: 3dkz, 2.4 Å

PDB Description: Crystal structure of the Q7W9W5_BORPA protein from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR208C.

PDB Compounds: (B:) Thioesterase superfamily protein

SCOPe Domain Sequences for d3dkzb_:

Sequence; same for both SEQRES and ATOM records:

>d3dkzb_ d.38.1.0 (B:) automated matches {Bordetella parapertussis [TaxId: 519]}
tdffgltipfmqllgvvpehsgngtartrlparadlvnsrgdihggtlmsvldftlgaai
rgdtpevgvatidmntsfmspgrgdlvietrclrrgasiafcegeirdsagelvakatat
fkii

Timeline for d3dkzb_:

• d3dkzb_ first appeared in SCOPe 2.03
  
• d3dkzb_ appears in SCOPe 2.04
  
• d3dkzb_ appears in SCOPe 2.06
  
• d3dkzb_ appears in the current release, SCOPe 2.08