Lineage for d3dkza_ (3dkz A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943538Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2943539Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) (S)
  5. 2944312Family d.38.1.0: automated matches [191325] (1 protein)
    not a true family
  6. 2944313Protein automated matches [190143] (42 species)
    not a true protein
  7. 2944365Species Bordetella parapertussis [TaxId:519] [225507] (1 PDB entry)
  8. 2944366Domain d3dkza_: 3dkz A: [209220]
    automated match to d1zkib_

Details for d3dkza_

PDB Entry: 3dkz (more details), 2.4 Å

PDB Description: Crystal structure of the Q7W9W5_BORPA protein from Bordetella parapertussis. Northeast Structural Genomics Consortium target BpR208C.
PDB Compounds: (A:) Thioesterase superfamily protein

SCOPe Domain Sequences for d3dkza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dkza_ d.38.1.0 (A:) automated matches {Bordetella parapertussis [TaxId: 519]}
tdffgltipfmqllgvvpehsgngtartrlparadlvnsrgdihggtlmsvldftlgaai
rgdtpevgvatidmntsfmspgrgdlvietrclrrgasiafcegeirdsagelvakatat
fkiiq

SCOPe Domain Coordinates for d3dkza_:

Click to download the PDB-style file with coordinates for d3dkza_.
(The format of our PDB-style files is described here.)

Timeline for d3dkza_:

View in 3D
Domains from other chains:
(mouse over for more information)
d3dkzb_