Lineage for d3dk9a3 (3dk9 A:364-478)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962835Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies)
    core: beta(3,4)-alpha(3); alpha+beta sandwich
  4. 2962836Superfamily d.87.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55424] (1 family) (S)
    both first two domains are of same beta/beta/alpha fold
  5. 2962837Family d.87.1.1: FAD/NAD-linked reductases, dimerisation (C-terminal) domain [55425] (11 proteins)
  6. 2962877Protein Glutathione reductase [55426] (3 species)
  7. 2962887Species Human (Homo sapiens) [TaxId:9606] [55427] (23 PDB entries)
  8. 2962888Domain d3dk9a3: 3dk9 A:364-478 [209219]
    Other proteins in same PDB: d3dk9a1, d3dk9a2
    automated match to d3grsa3
    complexed with fad, so4

Details for d3dk9a3

PDB Entry: 3dk9 (more details), 0.95 Å

PDB Description: catalytic cycle of human glutathione reductase near 1 a resolution
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d3dk9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dk9a3 d.87.1.1 (A:364-478) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]}
ynniptvvfshppigtvgltedeaihkygienvktystsftpmyhavtkrktkcvmkmvc
ankeekvvgihmqglgcdemlqgfavavkmgatkadfdntvaihptsseelvtlr

SCOPe Domain Coordinates for d3dk9a3:

Click to download the PDB-style file with coordinates for d3dk9a3.
(The format of our PDB-style files is described here.)

Timeline for d3dk9a3: