| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily) core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander |
Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) ![]() |
| Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins) duplication: both domains have similar folds and functions most members of the family contain common C-terminal alpha+beta domain |
| Protein Glutathione reductase, middle domain [418943] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [419397] (23 PDB entries) |
| Domain d3dk8a2: 3dk8 A:166-290 [209215] Other proteins in same PDB: d3dk8a1, d3dk8a3 automated match to d3grsa2 complexed with fad, gol, gsh, so4 |
PDB Entry: 3dk8 (more details), 1.1 Å
SCOPe Domain Sequences for d3dk8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3dk8a2 c.3.1.5 (A:166-290) Glutathione reductase, middle domain {Human (Homo sapiens) [TaxId: 9606]}
sqipgaslgitsdgffqleelpgrsvivgagyiavemagilsalgsktslmirhdkvlrs
fdsmistncteelenagvevlkfsqvkevkktlsglevsmvtavpgrlpvmtmipdvdcl
lwaig
Timeline for d3dk8a2: