Lineage for d1dfbh2 (1dfb H:127-229)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 53543Species Fab 3D6 (human), kappa L chain [48982] (1 PDB entry)
  8. 53544Domain d1dfbh2: 1dfb H:127-229 [20921]
    Other proteins in same PDB: d1dfbh1, d1dfbl1

Details for d1dfbh2

PDB Entry: 1dfb (more details), 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

SCOP Domain Sequences for d1dfbh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfbh2 b.1.1.2 (H:127-229) Immunoglobulin (constant domains of L and H chains) {Fab 3D6 (human), kappa L chain}
astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss
glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc

SCOP Domain Coordinates for d1dfbh2:

Click to download the PDB-style file with coordinates for d1dfbh2.
(The format of our PDB-style files is described here.)

Timeline for d1dfbh2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfbh1