Class b: All beta proteins [48724] (104 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species) |
Species Fab 3D6 (human), kappa L chain [48982] (1 PDB entry) |
Domain d1dfbh2: 1dfb H:127-229 [20921] Other proteins in same PDB: d1dfbh1, d1dfbl1 |
PDB Entry: 1dfb (more details), 2.7 Å
SCOP Domain Sequences for d1dfbh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dfbh2 b.1.1.2 (H:127-229) Immunoglobulin (constant domains of L and H chains) {Fab 3D6 (human), kappa L chain} astkgpsvfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqss glyslssvvtvpssslgtqtyicnvnhkpsntkvdkkvepksc
Timeline for d1dfbh2: