Lineage for d3dk4a1 (3dk4 A:17-165,A:291-363)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2849308Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
    core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander
  4. 2849309Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (9 families) (S)
  5. 2849878Family c.3.1.5: FAD/NAD-linked reductases, N-terminal and central domains [51943] (25 proteins)
    duplication: both domains have similar folds and functions
    most members of the family contain common C-terminal alpha+beta domain
  6. 2850017Protein Glutathione reductase, N- and C-terminal domain [418942] (3 species)
  7. 2850027Species Human (Homo sapiens) [TaxId:9606] [419396] (23 PDB entries)
  8. 2850031Domain d3dk4a1: 3dk4 A:17-165,A:291-363 [209209]
    Other proteins in same PDB: d3dk4a2, d3dk4a3
    automated match to d3grsa1
    complexed with fad, gsh, ndp, so4

    has additional insertions and/or extensions that are not grouped together

Details for d3dk4a1

PDB Entry: 3dk4 (more details), 1.2 Å

PDB Description: catalytic cycle of human glutathione reductase near 1 a resolution
PDB Compounds: (A:) glutathione reductase

SCOPe Domain Sequences for d3dk4a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3dk4a1 c.3.1.5 (A:17-165,A:291-363) Glutathione reductase, N- and C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
avasydylvigggsgglasarraaelgaraavveshklggtcvnvgcvpkkvmwntavhs
efmhdhadygfpscegkfnwrvikekrdayvsrlnaiyqnnltkshieiirghaaftsdp
kptievsgkkytaphiliatggmpstpheXrvpntkdlslnklgiqtddkghiivdefqn
tnvkgiyavgdvcgkalltpvaiaagrklahrlfeykedskld

SCOPe Domain Coordinates for d3dk4a1:

Click to download the PDB-style file with coordinates for d3dk4a1.
(The format of our PDB-style files is described here.)

Timeline for d3dk4a1: