Lineage for d1dfbl2 (1dfb L:107-212)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549707Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 549708Species Human (Homo sapiens) [TaxId:9606] [88569] (100 PDB entries)
    including humanized antibodies (chimeric proteins with human constant domains)
  8. 549783Domain d1dfbl2: 1dfb L:107-212 [20920]
    Other proteins in same PDB: d1dfbh1, d1dfbh2, d1dfbl1
    part of Fab 3D6

Details for d1dfbl2

PDB Entry: 1dfb (more details), 2.7 Å

PDB Description: structure of a human monoclonal antibody fab fragment against gp41 of human immunodeficiency virus type i

SCOP Domain Sequences for d1dfbl2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dfbl2 b.1.1.2 (L:107-212) Immunoglobulin light chain kappa constant domain, CL-kappa {Human (Homo sapiens)}
tvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqds
kdstyslsstltlskadyekhkvyacevthqglsspvtksfnrgec

SCOP Domain Coordinates for d1dfbl2:

Click to download the PDB-style file with coordinates for d1dfbl2.
(The format of our PDB-style files is described here.)

Timeline for d1dfbl2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1dfbl1