SCOPe 2.08: Domain d3djci2: 3djc I:123-255

Lineage for d3djci2 (3djc I:123-255)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (64 species)
   not a true protein

7. Species Legionella pneumophila [TaxId:272624] [225487] (1 PDB entry)

8. Domain d3djci2: 3djc I:123-255 [209199]
   Other proteins in same PDB: d3djca3, d3djcb3, d3djcc3, d3djcd3, d3djce3, d3djcf3, d3djcg3, d3djch3, d3djci3, d3djcj3, d3djck3, d3djcl3
   automated match to d3bexa2
   complexed with gol

Details for d3djci2

PDB Entry: 3djc, 2.4 Å

PDB Description: crystal structure of pantothenate kinase from legionella pneumophila

PDB Compounds: (I:) Type III pantothenate kinase

SCOPe Domain Sequences for d3djci2:

Sequence; same for both SEQRES and ATOM records:

>d3djci2 c.55.1.0 (I:123-255) automated matches {Legionella pneumophila [TaxId: 272624]}
qniividfgtattfcaishkkaylggailpglrlsadalskntaklpsveiiktesvvgr
stiesiqsgvyygvlgackeliqrihheafngdqililatggfaslfdkqglydhlvpdl
vlqgirlaammnt

Timeline for d3djci2:

• d3djci2 first appeared in SCOPe 2.03
  
• d3djci2 appears in SCOPe 2.07